General Information

  • ID:  hor002532
  • Uniprot ID:  A0A0C6E5W2(29-43)
  • Protein name:  Thais excitatory peptide-2
  • Gene name:  NA
  • Organism:  Reishia clavigera (Sea snail) (Purpura clavigera)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Reishia (genus), Muricidae (family), Muricoidea (superfamily), Neogastropoda (order), Caenogastropoda (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  KCYGKWAMHACWGGN
  • Length:  15(29-43)
  • Propeptide:  MKTDIQQALCLAMTLFVIVSTVIKPSEGKCYGKWAMHACWGGNGKRSDPSADLAPNPSVLRQLLLRNPPALDSREDASSYSDGLPEYNVPPPPAPSVSRLAALLRTLRTLQRENDALP
  • Signal peptide:  MKTDIQQALCLAMTLFVIVSTVIKPSEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in the contraction of the digestive and reproductive systems
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0C6E5W2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002532_AF2.pdbhor002532_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 196191 Formula: C76H106N22O18S3
Absent amino acids: DEFILPQRSTV Common amino acids: G
pI: 8.8 Basic residues: 3
Polar residues: 7 Hydrophobic residues: 4
Hydrophobicity: -55.33 Boman Index: -653
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 13.33
Instability Index: 6691.33 Extinction Coefficient cystines: 12615
Absorbance 280nm: 901.07

Literature

  • PubMed ID:  16309789
  • Title:  Novel Excitatory Neuropeptides Isolated From a Prosobranch Gastropod, Thais Clavigera: The Molluscan Counterpart of the Annelidan GGNG Peptides